Allergen

P35781.1

Accession P35781.1
External DB Link NCBI Protein
Species Vespa crabro
Common Name European hornet
Description unknown function, antigen 5
IUIS Name Vesp c 5
Length 202
Year Adopted 2007
Sequence >P35781.1 Vesp c 5; unknown function, antigen 5 [Vespa crabro]
NNYCKIKCRSGIHTLCKYGTSTKPNCGKNVVKASGLTKQENLEILKQHNEFRQKVARGLE
TRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQCNYGHDNCRNSAKYSVGQNIAEGSTTA
DNFGSVSNMVKMWEDEVKDYQYGSPKNKLNKVGHYTQMVWAKTKEIGCGSIKYIENGWHR
HYLVCNYGPAGNVGNEPIYERK
Parent Accession

Related Articles

Pubmed Authors Title Journal
8227862 Hoffman,D.R. Allergens in Hymenoptera venom. XXV: The amino acid sequences of antigen 5 molecules and the structural basis of antigenic cross-reactivity J. Allergy Clin. Immunol. 92 (5), 707-716 (1993)
3989146 Hoffman DR Allergens in Hymenoptera venom XIV: IgE binding activities of venom proteins from three species of vespids. J Allergy Clin Immunol. 1985 May;75(5):606-10
21114197 Severino MG; Caruso B; Bonadonna P; Labardi D; Macchia D; Campi P; Passalacqua G Cross reactivity between European hornet and yellow jacket venoms. Eur Ann Allergy Clin Immunol. 2010 Aug;42(4):141-5