Allergen

P35787.1

Accession P35787.1
External DB Link NCBI Protein
Species Vespula vidua
Common Name wasp
Description unknown function, antigen 5
IUIS Name Ves vi 5
Length 206
Year Adopted 2007
Sequence >P35787.1 Ves vi 5; unknown function, antigen 5 [Vespula vidua]
KVNYCKIKCLKGGVHTACKYGTSTKPNCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAKG
LETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYGHDTCKDTEKYPVGQNIAKRST
TAALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYVKD
EWYTHYLVCNYGPSGNFRNEKLYEKK
Parent Accession

Related Articles

Pubmed Authors Title Journal
8227862 Hoffman,D.R. Allergens in Hymenoptera venom. XXV: The amino acid sequences of antigen 5 molecules and the structural basis of antigenic cross-reactivity J. Allergy Clin. Immunol. 92 (5), 707-716 (1993)
8454859 Lu,G.; Villalba,M.; Coscia,M.R.; Hoffman,D.R.; King,T.P. Sequence analysis and antigenic cross-reactivity of a venom allergen, antigen 5, from hornets, wasps, and yellow jackets J. Immunol. 150 (7), 2823-2830 (1993)
6736487 Hoffman DR; Wood CL Allergens in Hymenoptera venom XI. Isolation of protein allergens from Vespula maculifrons (yellow jacket) venom. J Allergy Clin Immunol. 1984 Jul;74(1):93-103
12403934 Binder M; Fierlbeck G; King T; Valent P; Buhring HJ Individual hymenoptera venom compounds induce upregulation of the basophil activation marker ectonucleotide pyrophosphatase/phosphodiesterase 3 (CD203c) in sensitized patients. Int Arch Allergy Immunol. 2002 Oct;129(2):160-8
11790727 Hiller R; Laffer S; Harwanegg C; Huber M; Schmidt WM; Twardosz A; Barletta B; Becker WM; Blaser K; Breiteneder H; Chapman M; Crameri R; Duchene M; Ferreira F; Fiebig H; Hoffmann-Sommergruber K; King TP; Kleber-Janke T; Kurup VP; Lehrer SB; Lidholm J; Muller U; Pini C; Reese G; Scheiner O; Scheynius A; Shen HD; Spitzauer S; Suck R; Swoboda I; Thomas W; Tinghino R; Van Hage-Hamsten M; Virtanen T; Kraft D; Muller MW; Valenta R Microarrayed allergen molecules: diagnostic gatekeepers for allergy treatment. FASEB J. 2002 Mar;16(3):414-6
7065470 Hoffman DR; McDonald CA Allergens in hymenoptera venom. VIII. Immunologic comparison of venoms from six species of Vespula (yellow jackets). Ann Allergy. 1982 Feb;48(2):78-81
16197464 Bilo BM; Rueff F; Mosbech H; Bonifazi F; Oude-Elberink JN; the EAACI Interest Group on Insect Venom Hypersensitivity* Diagnosis of Hymenoptera venom allergy. Allergy. 2005 Nov;60(11):1339-49
21995714 Neis MM; Merk HF Value of component based diagnostics in IgE-mediated hymenoptera sting reactions. Cutan Ocul Toxicol. 2011 Oct 13;