Allergen

P49372.1

Accession P49372.1
External DB Link NCBI Protein
Species Apium graveolens
Common Name celery
Description pathogenesis related protein, PR-10, Bet v 1-like
IUIS Name Api g 1
Length 154
Year Adopted 2007
Sequence >P49372.1 Api g 1; pathogenesis related protein, PR-10, Bet v 1-like [Apium graveolens]
MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEIKGDGGPGTLKIITLPD
GGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIF
HTKGDAVVPEENIKYANEQNTALFKALEAYLIAN
Parent Accession

Related Articles

Pubmed Authors Title Journal
7588792 Breiteneder,H.; Hoffmann-Sommergruber,K.; O'Riordain,G.; Susani,M.; Ahorn,H.; Ebner,C.; Kraft,D.; Scheiner,O. Molecular characterization of Api g 1, the major allergen of celery (Apium graveolens), and its immunological and structural relationships to a group of 17-kDa tree pollen allergens Eur. J. Biochem. 233 (2), 484-489 (1995)
15713985 Erdmann SM; Sachs B; Schmidt A; Merk HF; Scheiner O; Moll-Slodowy S; Sauer I; Kwiecien R; Maderegger B; Hoffmann-Sommergruber K In vitro analysis of birch-pollen-associated food allergy by use of recombinant allergens in the basophil activation test. Int Arch Allergy Immunol. 2005 Mar;136(3):230-8
10932086 Luttkopf D; Ballmer-Weber BK; Wuthrich B; Vieths S Celery allergens in patients with positive double-blind placebo-controlled food challenge. J Allergy Clin Immunol. 2000 Aug;106(2):390-9
10452775 Hoffmann-Sommergruber K; Demoly P; Crameri R; Breiteneder H; Ebner C; Laimer Da Camara Machado M; Blaser K; Ismail C; Scheiner O; Bousquet J; Menz G IgE reactivity to Api g 1, a major celery allergen, in a Central European population is based on primary sensitization by Bet v 1. J Allergy Clin Immunol. 1999 Aug;104(2 Pt 1):478-84
10878490 Hoffmann-Sommergruber,K.; Ferris,R.; Pec,M.; Radauer,C.; O'Riordain,G.; Laimer Da Camara Machado,M.; Scheiner,O.; Breiteneder,H.; Characterization of api g 1.0201, a new member of the Api g 1 family of celery allergens Int. Arch. Allergy Immunol. 122 (2), 115-123 (2000)