Allergen

P55958.1

Accession P55958.1
External DB Link NCBI Protein
Species Parietaria judaica
Common Name pellitory
Description lipid transfer protein
IUIS Name Par j 2
Length 133
Year Adopted 2007
Sequence >P55958.1 Par j 2; lipid transfer protein [Parietaria judaica]
MRTVSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVKGEEKEPSKEC
CSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFD
CSKIQSTIFRGYY
Parent Accession

Related Articles

Pubmed Authors Title Journal
8985165 Duro,G.; Colombo,P.; Costa,M.A.; Izzo,V.; Porcasi,R.; Di Fiore,R.; Locorotondo,G.; Mirisola,M.G.; Cocchiara,R.; Geraci,D. cDNA cloning, sequence analysis and allergological characterization of Par j 2.0101, a new major allergen of the Parietaria judaica pollen FEBS Lett. 399 (3), 295-298 (1996)
16174987 Rossi RE; Monasterolo G; Coco G; Operti D Possible relationship between systemic side effects and sensitization to rPar j 2 in allergic patients submitted to an ultra-rush (20 min) sublingual immunotherapy and selected by component resolved diagnosis. Int Arch Allergy Immunol. 2005 Oct;138(2):105-10
12680870 Asturias JA; Gomez-Bayon N; Eseverri JL; Martinez A Par j 1 and Par j 2, the major allergens from Parietaria judaica pollen, have similar immunoglobulin E epitopes. Clin Exp Allergy. 2003 Apr;33(4):518-24
10753015 Costa MA; Duro G; Izzo V; Colombo P; Mirisola MG; Locorotondo G; Cocchiara R; Geraci D The IgE-binding epitopes of rPar j 2, a major allergen of Parietaria judaica pollen, are heterogeneously recognized among allergic subjects. Allergy. 2000 Mar;55(3):246-50