Allergen

P81943.3

Accession P81943.3
External DB Link NCBI Protein
Species Apium graveolens
Common Name celery
Description FAD-containing oxidase
IUIS Name Api g 5
Length 86
Year Adopted 2010
Sequence >P81943.3 Api g 5; FAD-containing oxidase [Apium graveolens]
LPNPSGFVTCLSSISKSVYTPAINLKAVIADPVAKTAVVQAGATLGEVYYXIIYARVLWV
GNTTQKLEWIRSLHDYQSSFFPFFSA
Parent Accession

Related Articles

Pubmed Authors Title Journal
10718855 Ganglberger,E.; Radauer,C.; Grimm,R.; Hoffmann-Sommergruber,K.; Breiteneder,H.; Scheiner,O.; Jensen-Jarolim,E.; N-terminal sequences of high molecular weight allergens from celery tuber Clin. Exp. Allergy 30 (4), 566-570 (2000)
12958180 Bublin,M.; Radauer,C.; Wilson,I.B.; Kraft,D.; Scheiner,O.; Breiteneder,H.; Hoffmann-Sommergruber,K.; Cross-reactive N-glycans of Api g 5, a high molecular weight glycoprotein allergen from celery, are required for immunoglobulin E binding and activation of effector cells from allergic patients FASEB J. 17 (12), 1697-1699 (2003)