Allergen

P86765.1

Accession P86765.1
External DB Link NCBI Protein
Species Merluccius merluccius
Common Name European hake
Description calcium-binding protein, parvalbumin
IUIS Name
Length 108
Year Adopted 2012
Sequence >P86765.1 calcium-binding protein, parvalbumin [Merluccius merluccius]
AFAGILADADITAALAACKAEGSFKHGEFFTKIGLKGKSAADIKKVFGIIDQDKSDFVEE
DELKLFLQNFSAGARALTDAETATFLKAGDSDGDGKIGVDEFAAMVKG
Parent Accession

Related Articles

Pubmed Authors Title Journal
19616851 Beale JE; Jeebhay MF; Lopata AL Characterisation of purified parvalbumin from five fish species and nucleotide sequencing of this major allergen from Pacific pilchard, Sardinops sagax. Mol Immunol. 2009 Sep;46(15):2985-93
4569071 Capony,J.P.; Ryden,L.; Demaille,J.; Pechere,J.F.; The primary structure of the major parvalbumin from hake muscle. Overlapping peptides obtained with chemical and enzymatic methods. The complete amino-acid sequence Eur. J. Biochem. 32 (1), 97-108 (1973)
20586483 Carrera,M.; Canas,B.; Vazquez,J.; Gallardo,J.M.; Extensive de novo sequencing of new parvalbumin isoforms using a novel combination of bottom-up proteomics, accurate molecular mass measurement by FTICR-MS, and selected MS/MS ion monitoring J. Proteome Res. 9 (9), 4393-4406 (2010)