Allergen

Q01882.2

Accession Q01882.2
External DB Link NCBI Protein
Species Oryza sativa
Common Name rice
Description unknown function
IUIS Name
Length 166
Year Adopted 2008
Sequence >Q01882.2 unknown function [Oryza sativa]
MASNKVVFSALLLIIVSVLAATATMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVK
RQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAE
VFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Parent Accession

Related Articles

Pubmed Authors Title Journal
7678765 Adachi,T.; Izumi,H.; Yamada,T.; Tanaka,K.; Takeuchi,S.; Nakamura,R.; Matsuda,T. Gene structure and expression of rice seed allergenic proteins belonging to the alpha-amylase/trypsin inhibitor family Plant Mol. Biol. 21 (2), 239-248 (1993)
1376283 Izumi,H.; Adachi,T.; Fujii,N.; Matsuda,T.; Nakamura,R.; Tanaka,K.; Urisu,A.; Kurosawa,Y. Nucleotide sequence of a cDNA clone encoding a major allergenic protein in rice seeds. Homology of the deduced amino acid sequence with members of alpha-amylase/trypsin inhibitor family FEBS Lett. 302 (3), 213-216 (1992)
8987539 Nakamura,R.; Matsuda,T. Rice allergenic protein and molecular-genetic approach for hypoallergenic rice Biosci. Biotechnol. Biochem. 60 (8), 1215-1221 (1996)
8765003 Tada Y; Nakase M; Adachi T; Nakamura R; Shimada H; Takahashi M; Fujimura T; Matsuda T Reduction of 14-16 kDa allergenic proteins in transgenic rice plants by antisense gene. FEBS Lett. 1996 Aug 12;391(3):341-5
10.1271/bbb1961.52.1465 Matsuda, T.; Sugiyaja, M.; Nakamura, R.; Torii, S. Purification and properties of an allergenic protein in rice grain Agric. Biol. Chem. 52(6), 1465-1470 (1988)