Allergen

Q875I9.1

Accession Q875I9.1
External DB Link NCBI Protein
Species Aspergillus fumigatus
Common Name fungus
Description chitosanase
IUIS Name
Length 238
Year Adopted 2016
Sequence >Q875I9.1 chitosanase [Aspergillus fumigatus]
MRLSEILTVALVTGATAYNLPNNLKQIYDKHKGKCSKVLAKGFTNGDASQGKSFSYCGDI
PGAIFISSSKGYTNMDIDCDGANNSAGKCANDPSGQGETAFKSDVKKFGISDLDANIHPY
VVFGNEDHSPKFKPQSHGMQPLSVMAVVCNGQLHYGIWGDTNGGVSTGEASISLADLCFP
NEHLDGNHGHDPNDVLFIGFTSKDAVPGATAKWKAKNAKEFEDSIKSIGDKLVAGLKA
Parent Accession

Related Articles

Pubmed Authors Title Journal
16372009 Nierman,W.C.; Pain,A.; Anderson,M.J.; Wortman,J.R.; Kim,H.S.; Arroyo,J.; Berriman,M.; Abe,K.; Archer,D.B.; Bermejo,C.; Bennett,J.; Bowyer,P.; Chen,D.; Collins,M.; Coulsen,R.; Davies,R.; Dyer,P.S.; Farman,M.; Fedorova,N.; Fedorova,N.; Feldblyum,T.V.; Fischer,R.; Fosker,N.; Fraser,A.; Garcia,J.L.; Garcia,M.J.; Goble,A.; Goldman,G.H.; Gomi,K.; Griffith-Jones,S.; Gwilliam,R.; Haas,B.; Haas,H.; Harris,D.; Horiuchi,H.; Huang,J.; Humphray,S.; Jimenez,J.; Keller,N.; Khouri,H.; Kitamoto,K.; Kobayashi,T.; Konzack,S.; Kulkarni,R.; Kumagai,T.; Lafon,A.; Latge,J.P.; Li,W.; Lord,A.; Lu,C.; Majoros,W.H.; May,G.S.; Miller,B.L.; Mohamoud,Y.; Molina,M.; Monod,M.; Mouyna,I.; Mulligan,S.; Murphy,L.; O'Neil,S.; Paulsen,I.; Penalva,M.A.; Pertea,M.; Price,C.; Pritchard,B.L.; Quail,M.A.; Rabbinowitsch,E.; Rawlins,N.; Rajandream,M.A.; Reichard,U.; Renauld,H.; Robson,G.D.; Rodriguez de Cordoba,S.; Rodriguez-Pena,J.M.; Ronning,C.M.; Rutter,S.; Salzberg,S.L.; Sanchez,M.; Sanchez-Ferrero,J.C.; Saunders,D.; Seeger,K.; Squares,R.; Squares,S.; Takeuchi,M.; Tekaia,F.; Turner,G.; Vazquez de Aldana,C.R.; Weidman,J.; White,O.; Woodward,J.; Yu,J.H.; Fraser,C.; Galagan,J.E.; Asai,K.; Machida,M.; Hall,N.; Barrell,B.; Denning,D.W.; Genomic sequence of the pathogenic and allergenic filamentous fungus Aspergillus fumigatus Nature 438 (7071), 1151-1156 (2005)
11115392 Cheng,C.Y.; Li,Y.K.; An Aspergillus chitosanase with potential for large-scale preparation of chitosan oligosaccharides Biotechnol. Appl. Biochem. 32 (PT 3), 197-203 (2000)
16396247 Schwienbacher,M.; Weig,M.; Thies,S.; Regula,J.T.; Heesemann,J.; Ebel,F.; Analysis of the major proteins secreted by the human opportunistic pathogen Aspergillus fumigatus under in vitro conditions Med. Mycol. 43 (7), 623-630 (2005)
17651155 Gautam,P.; Sundaram,C.S.; Madan,T.; Gade,W.N.; Shah,A.; Sirdeshmukh,R.; Sarma,P.U.; Identification of novel allergens of Aspergillus fumigatus using immunoproteomics approach Clin. Exp. Allergy 37 (8), 1239-1249 (2007)
16330537 Cheng,C.Y.; Chang,C.H.; Wu,Y.J.; Li,Y.K.; Exploration of glycosyl hydrolase family 75, a chitosanase from Aspergillus fumigatus J. Biol. Chem. 281 (6), 3137-3144 (2006)
22160328 Chen,X.; Zhai,C.; Kang,L.; Li,C.; Yan,H.; Zhou,Y.; Yu,X.; Ma,L.; High-level expression and characterization of a highly thermostable chitosanase from Aspergillus fumigatus in Pichia pastoris Biotechnol. Lett. 34 (4), 689-694 (2012)
24880790 Beck J; Broniszewska M; Schwienbacher M; Ebel F Characterization of the Aspergillus fumigatus chitosanase CsnB and evaluation of its potential use in serological diagnostics. Int J Med Microbiol. 2014 Jul;304(5-6):696-702