Article
Characterization of Der p V allergen, cDNA analysis, and IgE-mediated reactivity to the recombinant protein
| Id | 146 |
|---|---|
| Pubmed | 7798547 |
Authors
Lin,K.L.; Hsieh,K.H.; Thomas,W.R.; Chiang,B.L.; Chua,K.Y.
Title
Characterization of Der p V allergen, cDNA analysis, and IgE-mediated reactivity to the recombinant protein
Journal
J. Allergy Clin. Immunol. 94 (6 PT 1), 989-996 (1994)
Pubmed ID
7798547Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 72 | Dermatophagoides pteronyssinus | house dust mite | unknown function | 0000009072 | CAA35692.1 | 148 | 146, 222, 2511, 7687, 7750, 15149 | 2015 | LFLENKDPKPLKKISIMKFIIAFFVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKK GELALFYLQEQINHFEEKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQY NLEMAKKSGDILERDLKKEEARVKKIEV | >CAA35692.1 Der p 5; unknown function [Dermatophagoides pteronyssinus] | View Edit Delete |
| 350 | Dermatophagoides pteronyssinus | house dust mite | unknown function | 0000913285 | AAB32842.1 | 132 | 146, 222, 2511, 7687, 7750, 15149 | 2007 | MKFIIAFFVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKKGELALFYLQEQINHFE AKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMAKKSGDILERDL KKEEARVKKIEV | >AAB32842.1 Der p 5; unknown function [Dermatophagoides pteronyssinus] | View Edit Delete |
| 997 | Dermatophagoides pteronyssinus | house dust mite | unknown function | 0028798085 | CAD69036.1 | 132 | 146, 222, 2511, 7687, 7750, 15149 | 2007 | MKFIIAFFVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKKGELALFYLQEQINHFE EKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMLKKSGDILERDL KKEEARVKNIEV | >CAD69036.1 Der p 5; unknown function [Dermatophagoides pteronyssinus] | View Edit Delete |