Article
Isoform identification, recombinant production and characterization of the allergen lipid transfer protein 1 from pear (Pyr c 3)
| Id | 17952 |
|---|---|
| Pubmed | 22015956 |
Authors
Ramazzina,I.; Amato,S.; Passera,E.; Sforza,S.; Mistrello,G.; Berni,R.; Folli,C.;
Title
Isoform identification, recombinant production and characterization of the allergen lipid transfer protein 1 from pear (Pyr c 3)
Journal
Gene 491 (2), 173-181 (2012)
Pubmed ID
22015956Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 725 | Pyrus communis | pear | lipid transfer protein | 0006715524 | AAF26451.1 | 115 | 2436, 2445, 17952 | 2011 | MASSAVIKLALVVALCMAVSVAHAITCSQVSANLAPCINYVRSGGAVPPACCNGIKTING LAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKCGVNVPYKISTSTNCATVK | >AAF26451.1 Pyr c 3; lipid transfer protein [Pyrus communis] | View Edit Delete |
| 1853 | Pyrus communis | pear | lipid transfer protein | 0355525856 | AET05730.1 | 94 | 2436, 2445, 17952 | 2013 | AHAITCSQVSSNLAPCINYVRSGGAVPPACCNGIKTINGLANTTPDRQAACNCLKNLAGS VSGVNPGNAESLPGKCGVNVPYKISTSTNCATVK | >AET05730.1 Pyr c 3; lipid transfer protein [Pyrus communis] | View Edit Delete |
| 1854 | Pyrus communis | pear | lipid transfer protein | 0355525860 | AET05732.1 | 94 | 2436, 2445, 17952 | 2013 | AHAITCSQVSSNLAPCINYVRSGGAVPPACCNGIKTINGLANTTPDRQAACNCLKNLAGS VSGVNPGNAESLPGKCGVNVPCKISTPTNCATVK | >AET05732.1 Pyr c 3; lipid transfer protein [Pyrus communis] | View Edit Delete |
| 1855 | Pyrus communis | pear | lipid transfer protein, partial | 0355525862 | AET05733.1 | 94 | 2436, 2445, 17952 | 2013 | AHAITCSQVTSNLGACIGYVKNGGVVPPACCNGIRTVNGLARTTADRQTTCNCLKSLAGS IKGVNPNNAATLPGKCGVNVPFKISTSTNCATVK | >AET05733.1 lipid transfer protein, partial [Pyrus communis] | View Edit Delete |