Article

Identification of the major allergens in wheat flour responsible for baker's asthma

Id	1900
Pubmed	9494090

Amano,M.; Ogawa,H.; Kojima,K.; Kamidaira,T.; Suetsugu,S.; Yoshihama,M.; Satoh,T.; Samejima,T.; Matsumoto,I.;

Biochem. J. 330 (Pt 3), 1229-1234 (1998)

9494090

Id	Species	Common Name	Definition	Gi	Accession	Length	Reference	Year Adopted	Sequence	Header	Actions
617	Triticum aestivum	wheat	unknown function, partial	0003913017	P81496.1	27	1900, 2403, 2486	2007	SFREQCVPGREITYECLNACAEYAVRQ	>P81496.1 unknown function, partial [Triticum aestivum]	View Edit Delete
1703	Triticum aestivum	wheat	alpha-amylase inhibitor	0283465829	CBA13560.1	121	1900, 18607	2011	SGPWSWCDPATGYKVSALTGCRAMVKLQCVGSQVPEAVLRDCCQQLADVNNEWCRCEDLS SMLRSVYQELGAREGKEVLPGCRKEVMKLTAASVPEVRKVPIPNPSGDRAGVCYWAAYPD V	>CBA13560.1 Tri a 15; alpha-amylase inhibitor [Triticum aestivum]	View Edit Delete