Article
Baker's asthma_frequence of specific IgE to recombinant wheat flour allergens in German, Dutch and Spanish Bakers
| Id | 19459 |
|---|---|
| Pubmed |
Authors
Sander I, Rihs H, Razynek P, Doekes G, Quirce S, van Kampen V, Bruning T, Raljf-Heimsoth M.
Title
Baker's asthma_frequence of specific IgE to recombinant wheat flour allergens in German, Dutch and Spanish Bakers
Journal
Allergy 67, Suppl 96 2012 pg 74
Pubmed ID
Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 1423 | Triticum aestivum | wheat | serine protease inhibitor | 0122065237 | P82977.2 | 84 | 9312, 12996, 19187, 19459 | 2011 | MSSVVKKPLGGNTDTGDHHNQKTEWPELVGKSVEEAKKVILQDKSEAQIVVLPVGTIVTM EYRIDRVRLFVDSLDKIAQVPRVG | >P82977.2 Tri a 39; serine protease inhibitor [Triticum aestivum] | View Edit Delete |
| 1475 | Triticum aestivum | wheat | serine protease inhibitor | 0154101366 | ABS58503.1 | 84 | 9312, 12996, 19187, 19459 | 2010 | MSPVVKKPEGGNTDTGDHHNQKTEWPELVGKSVEEAKKVIMQDKSEAQIVVLPVGTIVTM EYRIDRVRLFVDSLDKIAQVPRVG | >ABS58503.1 Tri a 39; serine protease inhibitor [Triticum aestivum] | View Edit Delete |
| 1883 | Triticum aestivum | wheat | serine protease inhibitor | 0403213259 | CCK33471.1 | 84 | 9312, 12996, 19187, 19459 | 2014 | MSPVVKKPEGRNTDTSDHHNQKTEWPELVGKSVEEAKKVILQDKSEAQIVVLPVGTIVTM EYRIDRVRLFVDSLDKIAQVPRVG | >CCK33471.1 Tri a 39; serine protease inhibitor [Triticum aestivum] | View Edit Delete |