Article
Fish allergens at a glance: variable allergenicity of parvalbumins, the major fish allergens.
| Id | 20180 |
|---|---|
| Pubmed | 24795722 |
Authors
Kuehn A; Swoboda I; Arumugam K; Hilger C; Hentges F
Title
Fish allergens at a glance: variable allergenicity of parvalbumins, the major fish allergens.
Journal
Front Immunol. 2014;5:179
Pubmed ID
24795722Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 1680 | Clupea harengus | Atlantic herring | calcium-binding protein, parvalbumin | 0242253963 | CAQ72970.1 | 109 | 2308, 12924, 12924, 20180, 20182 | 2011 | MALASLLKGADIDAALKACEAKDSFKHKDFFAKIGLATKSAADLKKAFEIIDQDKSGFIE EEELKLFLQNFKAGARALTDAETKAFLKAGDADGDGMIGVDEFAVMIKP | >CAQ72970.1 Clu h 1; calcium-binding protein, parvalbumin [Clupea harengus] | View Edit Delete |
| 1681 | Clupea harengus | Atlantic herring | calcium-binding protein, parvalbumin | 0242253965 | CAQ72971.1 | 110 | 2308, 12924, 12924, 20180, 20182 | 2011 | MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVKAR | >CAQ72971.1 Clu h 1; calcium-binding protein, parvalbumin [Clupea harengus] | View Edit Delete |
| 1682 | Clupea harengus | Atlantic herring | calcium-binding protein, parvalbumin | 0242253967 | CAQ72972.1 | 109 | 2308, 12924, 12924, 20180, 20182 | 2011 | MAFAAFLKEADITAALGACKGADSFDHKAFFAKVGLKGKSGDELKKAFEIIDQDKSGFIE EEELKLFLQNFCKGARALTDGETKKFLKAGDSDNDGKIGIDEFAALINH | >CAQ72972.1 Clu h 1; calcium-binding protein, parvalbumin [Clupea harengus] | View Edit Delete |