Article
CONFIDENTIAL: Comparison of IgE binding to 25 species of fish extracts
Id | 20252 |
---|---|
Pubmed |
Authors
Lee PW, Nordlee JA, Koppelman SJ, Baumert JL, Taylor SL
Title
CONFIDENTIAL: Comparison of IgE binding to 25 species of fish extracts
Journal
CONFIDENTIAL: part of dissertation
Pubmed ID
Related Allergens
Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
---|---|---|---|---|---|---|---|---|---|---|---|
1678 | Sebastes marinus | ocean perch (red fish) | calcium-binding protein, parvalbumin | 0242253959 | CAQ72968.1 | 109 | 12924, 19831, 20252, 20258 | 2011 | MALAASLNAADITAALAACSGVDTFKHKDFFGKVGLSAKSADDIKNAFKVIDQDKSGFIE EEELKLFLQNFSATARALTEAETTAFLKAGDSDGDGMIGMDEFAAMVKG | >CAQ72968.1 Seb m 1; calcium-binding protein, parvalbumin [Sebastes marinus] | View Edit Delete |
1679 | Sebastes marinus | ocean perch (red fish) | calcium-binding protein, parvalbumin | 0242253961 | CAQ72969.1 | 110 | 12924, 19831, 20252, 20258 | 2011 | MAFASVGLKDADIAAALDGCKDAGKFNHKTFFKTCGLSGKSSDEVKKAFAIIDQDISGFI EEEELKLFLQTFKAGARALSDAETKEFLKAGDSDGDGKIGADEWAAMVKQ | >CAQ72969.1 Seb m 1; calcium-binding protein, parvalbumin [Sebastes marinus] | View Edit Delete |