Article

Identification of two metallothioneins as novel inhalative coffee allergens cof a 2 and cof a 3.

Id	20559
Pubmed	25962169

Peters U; Frenzel K; Brettschneider R; Oldenburg M; Bittner C

PLoS One. 2015;10(5):e0126455

25962169

Id	Species	Common Name	Definition	Gi	Accession	Length	Reference	Year Adopted	Sequence	Header	Actions
1928	Coffea arabica	coffee	metallothionein	0494319674	AGL34967.1	80	20559	2015	MSCCGGNCGCGAGCKCSGGCGGCKMYPELSYTENTAAETLILGVAPPKTAYLEGAGEEAA AENGGCKCGPDCKCNPCNCK	>AGL34967.1 Cof a 2; metallothionein [Coffea arabica]	View Edit Delete
1929	Coffea arabica	coffee	metallothionein	0494319676	AGL34968.1	65	20559	2015	MSDKCGNCDCADRSQCVKKGSSYAADIVETENTFVETFVMMEGGAQNGKCKCGPSCACVN CTCDN	>AGL34968.1 Cof a 3; metallothionein [Coffea arabica]	View Edit Delete