Article
New wheat allergens related to baker
| Id | 20643 |
|---|---|
| Pubmed | 26100087 |
Authors
Bittner C; Peters U; Frenzel K; Müsken H; Brettschneider R
Title
New wheat allergens related to baker
Journal
J Allergy Clin Immunol. 2015 Jun 19;
Pubmed ID
26100087Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 2015 | Triticum aestivum | wheat | elongation factor | 0827354784 | AKJ77985.1 | 89 | 20643 | 2016 | MGKRKAAAKPPPRKGMDKLDTVFSCPFCNHGSSVECRIDLKNLIGEANCQICQESFSTTA NALTEAIDVYSEWIDECERVNTVEGDDGA | >AKJ77985.1 Tri a 45; elongation factor [Triticum aestivum] | View Edit Delete |
| 2016 | Triticum aestivum | wheat | unknown function | 0827354790 | AKJ77986.1 | 76 | 20643 | 2016 | EFTNTCMECLVCDVHVACGDFASNDVIDPAKFRRLGINDCLVNDGKSIEPSFPVSFQYGN SFPYPMTVASASCDCN | >AKJ77986.1 Tri a 42; unknown function [Triticum aestivum] | View Edit Delete |
| 2017 | Triticum aestivum | wheat | unknown function | 0827354822 | AKJ77987.1 | 108 | 20643 | 2016 | MTLVASSSLDPVWVEVLGDPLLRRLLLRFIFCRATLSLFKASNDKAECLPSCVPPLPESV GGESMLSQCCVMRVASFLGAADQFSFAEVTTWPDIDEPTSSGGVDKEL | >AKJ77987.1 Tri a 43; unknown function [Triticum aestivum] | View Edit Delete |
| 2018 | Triticum aestivum | wheat | mitochondrial ubiquitin ligase activator of NFKB 1 | 0827354845 | AKJ77988.1 | 60 | 20643 | 2016 | EMGDGQLCVICLRKRRRAAFVPCGHLVCCCNCAKRVELMDEPLCPVCRQDIQYMLRVYDS | >AKJ77988.1 Tri a 41; mitochondrial ubiquitin ligase activator of NFKB 1 [Triticum aestivum] | View Edit Delete |
| 2019 | Triticum aestivum | wheat | endosperm transfer cell specific PR60 | 0827354912 | AKJ77990.1 | 107 | 20643 | 2016 | MAKLMCLCFIILTIAVVVSADECEGDRQEMIKQCAKYQQWPANPKVNPSDACCAVWQKAN IPCLCAGVTKEKEKIWCMEKVAYVANFCKKPFPHGYKCGSYTFPPLA | >AKJ77990.1 Tri a 44; endosperm transfer cell specific PR60 [Triticum aestivum] | View Edit Delete |