Article

Pomegranate Cultivars: Identification of the New IgE-Binding Protein Pommaclein and Analysis of Antioxidant Variability.

Id	20727
Pubmed	28290690

Tuppo L, Alessandri C, Pasquariello MS, Petriccione M, Giangrieco I, Tamburrini M, Mari A2, Ciardiello MA.

J Agric Food Chem. 2017 Apr 5;65(13):2702-2710. doi: 10.1021/acs.jafc.7b00092. Epub 2017 Mar 27.

28290690

Id	Species	Common Name	Definition	Gi	Accession	Length	Reference	Year Adopted	Sequence	Header	Actions
47	Punica granatum	pomegranate	gibberellin-regulated protein		C0HKC0.1	20	20727	2018	GSSFCDSKCAVRCSKAGVQD	>C0HKC0.1 Pun g 7; gibberellin-regulated protein [Punica granatum]	View Edit Delete
49	Thaumetopoea solitaria	moth	unknown function		CEE03318.1	100	20727	2018	VPQLSEKAEKAVDLTYQEKNNLFELGSVVGDIISKNGCHVSFGCHKGYCWAGCGNPTNPW SWGENWCYTTKTYSQSYSYVQCTQDSECDGCWKCGGPCSA	>CEE03318.1 unknown function [Thaumetopoea solitaria]	View Edit Delete