Article
Identification of Allergenic Proteins in Velvet Mesquite (Prosopis velutina) Pollen: An Immunoproteomics Approach
| Id | 21155 |
|---|---|
| Pubmed | 36143457 |
Authors
Huerta-Ocampo, JA, Batista-Roche, L. G., Morales-Amparano, M. B., Robles-Burgueno, M. D. R., Ramos-Clamont Montfort, G., Vazquez-Moreno, L., Ramirez-Jimenez, F. and Teran, L. M.
Title
Identification of Allergenic Proteins in Velvet Mesquite (Prosopis velutina) Pollen: An Immunoproteomics Approach
Journal
Life (Basel). 2022 Sep 13; 12(9):
Pubmed ID
36143457Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 3570 | Prosopis velutina | velvet mesquite | fructose-bisphosphate aldolase, partial | COMPARE00545 | 19 | 21155 | 2024 | KYQDELIANAAYIGTPGKG | >COMPARE00545 fructose-bisphosphate aldolase, partial [Prosopis velutina] | View Edit Delete | |
| 3571 | Prosopis velutina | velvet mesquite | fructose-bisphosphate aldolase, partial | COMPARE00546 | 14 | 21155 | 2024 | RVAPEVIAEHTVRA | >COMPARE00546 fructose-bisphosphate aldolase, partial [Prosopis velutina] | View Edit Delete | |
| 3572 | Prosopis velutina | velvet mesquite | fructose-bisphosphate aldolase, partial | COMPARE00547 | 14 | 21155 | 2024 | KTASGKPFVDVLKE | >COMPARE00547 fructose-bisphosphate aldolase, partial [Prosopis velutina] | View Edit Delete | |
| 3573 | Prosopis velutina | velvet mesquite | fructose-bisphosphate aldolase, partial | COMPARE00548 | 15 | 21155 | 2024 | RLASINVENVESNRR | >COMPARE00548 fructose-bisphosphate aldolase, partial [Prosopis velutina] | View Edit Delete | |
| 3574 | Prosopis velutina | velvet mesquite | fructose-bisphosphate aldolase, partial | COMPARE00549 | 22 | 21155 | 2024 | KIGPNEPSPLAIHENAYGLARY | >COMPARE00549 fructose-bisphosphate aldolase, partial [Prosopis velutina] | View Edit Delete | |
| 3575 | Prosopis velutina | velvet mesquite | fructose-bisphosphate aldolase, partial | COMPARE00550 | 17 | 21155 | 2024 | KGILAADESTGTIGKRL | >COMPARE00550 fructose-bisphosphate aldolase, partial [Prosopis velutina] | View Edit Delete | |
| 3576 | Prosopis velutina | velvet mesquite | fructose-bisphosphate aldolase, partial | COMPARE00551 | 16 | 21155 | 2024 | KGILAADESTGTIGKR | >COMPARE00551 fructose-bisphosphate aldolase, partial [Prosopis velutina] | View Edit Delete | |
| 3577 | Prosopis velutina | velvet mesquite | fructose-bisphosphate aldolase, partial | COMPARE00552 | 11 | 21155 | 2024 | KEGGVLPGIKV | >COMPARE00552 fructose-bisphosphate aldolase, partial [Prosopis velutina] | View Edit Delete | |
| 3578 | Prosopis velutina | velvet mesquite | fructose-bisphosphate aldolase, partial | COMPARE00553 | 13 | 21155 | 2024 | KANSEATLGTYKG | >COMPARE00553 fructose-bisphosphate aldolase, partial [Prosopis velutina] | View Edit Delete | |
| 3579 | Prosopis velutina | velvet mesquite | fructose-bisphosphate aldolase, partial | COMPARE00554 | 10 | 21155 | 2024 | RALQQSTIKA | >COMPARE00554 fructose-bisphosphate aldolase, partial [Prosopis velutina] | View Edit Delete | |
| 3554 | Prosopis velutina | velvet mesquite | glucan endo-1,3-beta-glucosidase, partial | COMPARE00555 | 15 | 21155 | 2024 | KYIAVGNEVNPVGRN | >COMPARE00555 glucan endo-1,3-beta-glucosidase, partial [Prosopis velutina] | View Edit Delete | |
| 3555 | Prosopis velutina | velvet mesquite | glucan endo-1,3-beta-glucosidase, partial | COMPARE00556 | 10 | 21155 | 2024 | RTYLDNLIRH | >COMPARE00556 glucan endo-1,3-beta-glucosidase, partial [Prosopis velutina] | View Edit Delete | |
| 3556 | Prosopis velutina | velvet mesquite | glucan endo-1,3-beta-glucosidase, partial | COMPARE00557 | 15 | 21155 | 2024 | RLYDPNQAALEALRN | >COMPARE00557 glucan endo-1,3-beta-glucosidase, partial [Prosopis velutina] | View Edit Delete | |
| 3557 | Prosopis velutina | velvet mesquite | glucan endo-1,3-beta-glucosidase, partial | COMPARE00558 | 23 | 21155 | 2024 | RGYQNLFDALLDSVHAALDSTKI | >COMPARE00558 glucan endo-1,3-beta-glucosidase, partial [Prosopis velutina] | View Edit Delete | |
| 3558 | Prosopis velutina | velvet mesquite | glucan endo-1,3-beta-glucosidase, partial | COMPARE00559 | 12 | 21155 | 2024 | RAVQNVYQAIRA | >COMPARE00559 glucan endo-1,3-beta-glucosidase, partial [Prosopis velutina] | View Edit Delete | |
| 3548 | Prosopis velutina | velvet mesquite | glutelin, partial | COMPARE00562 | 14 | 21155 | 2024 | KLALEKNGFALPRY | >COMPARE00562 glutelin, partial [Prosopis velutina] | View Edit Delete | |
| 3549 | Prosopis velutina | velvet mesquite | glutelin, partial | COMPARE00563 | 12 | 21155 | 2024 | RAQVVGPDGKRV | >COMPARE00563 glutelin, partial [Prosopis velutina] | View Edit Delete | |
| 3550 | Prosopis velutina | velvet mesquite | glutelin, partial | COMPARE00564 | 12 | 21155 | 2024 | RTSDAIFFPPPK | >COMPARE00564 glutelin, partial [Prosopis velutina] | View Edit Delete | |
| 3551 | Prosopis velutina | velvet mesquite | glutelin, partial | COMPARE00565 | 11 | 21155 | 2024 | KTLVGSQSGKG | >COMPARE00565 glutelin, partial [Prosopis velutina] | View Edit Delete | |
| 3552 | Prosopis velutina | velvet mesquite | glutelin, partial | COMPARE00566 | 18 | 21155 | 2024 | KALSPTVLQAGFNVDSKL | >COMPARE00566 glutelin, partial [Prosopis velutina] | View Edit Delete | |
| 3553 | Prosopis velutina | velvet mesquite | glutelin, partial | COMPARE00567 | 11 | 21155 | 2024 | KAGNLFIVPRF | >COMPARE00567 glutelin, partial [Prosopis velutina] | View Edit Delete | |
| 3559 | Prosopis velutina | velvet mesquite | glyceraldehyde-3-phosphate-dehydrogenase, partial | COMPARE00568 | 16 | 21155 | 2024 | RVPTVDVSVVDLTVRL | >COMPARE00568 glyceraldehyde-3-phosphate-dehydrogenase, partial [Prosopis velutina] | View Edit Delete | |
| 3560 | Prosopis velutina | velvet mesquite | glyceraldehyde-3-phosphate-dehydrogenase, partial | COMPARE00569 | 10 | 21155 | 2024 | KVLPSLNGKL | >COMPARE00569 glyceraldehyde-3-phosphate-dehydrogenase, partial [Prosopis velutina] | View Edit Delete | |
| 3561 | Prosopis velutina | velvet mesquite | glyceraldehyde-3-phosphate-dehydrogenase, partial | COMPARE00570 | 10 | 21155 | 2024 | KVIISAPSKD | >COMPARE00570 glyceraldehyde-3-phosphate-dehydrogenase, partial [Prosopis velutina] | View Edit Delete | |
| 3562 | Prosopis velutina | velvet mesquite | glyceraldehyde-3-phosphate-dehydrogenase, partial | COMPARE00571 | 17 | 21155 | 2024 | KTLVFGDKPVSVFGTKN | >COMPARE00571 glyceraldehyde-3-phosphate-dehydrogenase, partial [Prosopis velutina] | View Edit Delete | |
| 3563 | Prosopis velutina | velvet mesquite | glyceraldehyde-3-phosphate-dehydrogenase, partial | COMPARE00572 | 23 | 21155 | 2024 | KSDINIVSNASCTTNCLAPLAKV | >COMPARE00572 glyceraldehyde-3-phosphate-dehydrogenase, partial [Prosopis velutina] | View Edit Delete | |
| 3564 | Prosopis velutina | velvet mesquite | glyceraldehyde-3-phosphate-dehydrogenase, partial | COMPARE00573 | 10 | 21155 | 2024 | KIGINGFGRI | >COMPARE00573 glyceraldehyde-3-phosphate-dehydrogenase, partial [Prosopis velutina] | View Edit Delete | |
| 3565 | Prosopis velutina | velvet mesquite | glyceraldehyde-3-phosphate-dehydrogenase, partial | COMPARE00574 | 22 | 21155 | 2024 | KGVLGYTEDDVVSTDFVGDCRS | >COMPARE00574 glyceraldehyde-3-phosphate-dehydrogenase, partial [Prosopis velutina] | View Edit Delete | |
| 3566 | Prosopis velutina | velvet mesquite | glyceraldehyde-3-phosphate-dehydrogenase, partial | COMPARE00575 | 20 | 21155 | 2024 | KEASEGSLKGKGASYDEIKA | >COMPARE00575 glyceraldehyde-3-phosphate-dehydrogenase, partial [Prosopis velutina] | View Edit Delete | |
| 3567 | Prosopis velutina | velvet mesquite | glyceraldehyde-3-phosphate-dehydrogenase, partial | COMPARE00576 | 14 | 21155 | 2024 | KDAPMFVVGVNEKE | >COMPARE00576 glyceraldehyde-3-phosphate-dehydrogenase, partial [Prosopis velutina] | View Edit Delete | |
| 3568 | Prosopis velutina | velvet mesquite | glyceraldehyde-3-phosphate-dehydrogenase, partial | COMPARE00577 | 13 | 21155 | 2024 | KAGISLSNNFVKL | >COMPARE00577 glyceraldehyde-3-phosphate-dehydrogenase, partial [Prosopis velutina] | View Edit Delete | |
| 3569 | Prosopis velutina | velvet mesquite | glyceraldehyde-3-phosphate-dehydrogenase, partial | COMPARE00578 | 17 | 21155 | 2024 | RAASFNIIPSSTGAAKA | >COMPARE00578 glyceraldehyde-3-phosphate-dehydrogenase, partial [Prosopis velutina] | View Edit Delete | |
| 3585 | Prosopis velutina | velvet mesquite | polygalacturonase, partial | COMPARE00579 | 15 | 21155 | 2024 | RYDNEAPVSNVNVKN | >COMPARE00579 polygalacturonase, partial [Prosopis velutina] | View Edit Delete | |
| 3586 | Prosopis velutina | velvet mesquite | polygalacturonase, partial | COMPARE00580 | 15 | 21155 | 2024 | RYNNEQPVSNVNVKN | >COMPARE00580 polygalacturonase, partial [Prosopis velutina] | View Edit Delete | |
| 3587 | Prosopis velutina | velvet mesquite | polygalacturonase, partial | COMPARE00581 | 18 | 21155 | 2024 | KVLVGAGTYNMNAVDLKG | >COMPARE00581 polygalacturonase, partial [Prosopis velutina] | View Edit Delete | |
| 3588 | Prosopis velutina | velvet mesquite | polygalacturonase, partial | COMPARE00582 | 15 | 21155 | 2024 | KAWTDACAATEASKV | >COMPARE00582 polygalacturonase, partial [Prosopis velutina] | View Edit Delete | |
| 3580 | Prosopis velutina | velvet mesquite | S-adenosylmethionine synthase 1-like, partial | COMPARE00583 | 10 | 21155 | 2024 | KVACETCTKT | >COMPARE00583 S-adenosylmethionine synthase 1-like, partial [Prosopis velutina] | View Edit Delete | |
| 3581 | Prosopis velutina | velvet mesquite | S-adenosylmethionine synthase 1-like, partial | COMPARE00584 | 11 | 21155 | 2024 | KSVVASGLARR | >COMPARE00584 S-adenosylmethionine synthase 1-like, partial [Prosopis velutina] | View Edit Delete | |
| 3582 | Prosopis velutina | velvet mesquite | S-adenosylmethionine synthase 1-like, partial | COMPARE00585 | 19 | 21155 | 2024 | RGIGFVSADVGLDADNCKV | >COMPARE00585 S-adenosylmethionine synthase 1-like, partial [Prosopis velutina] | View Edit Delete | |
| 3583 | Prosopis velutina | velvet mesquite | S-adenosylmethionine synthase 1-like, partial | COMPARE00586 | 17 | 21155 | 2024 | RFVIGGPHGDAGLTGRK | >COMPARE00586 S-adenosylmethionine synthase 1-like, partial [Prosopis velutina] | View Edit Delete | |
| 3536 | Prosopis velutina | velvet mesquite | superoxide dismutase, partial | COMPARE00587 | 10 | 21155 | 2024 | KYASEVYEKE | >COMPARE00587 superoxide dismutase, partial [Prosopis velutina] | View Edit Delete | |
| 3537 | Prosopis velutina | velvet mesquite | superoxide dismutase, partial | COMPARE00588 | 17 | 21155 | 2024 | RLVVETTANQDPLVTKG | >COMPARE00588 superoxide dismutase, partial [Prosopis velutina] | View Edit Delete | |
| 3538 | Prosopis velutina | velvet mesquite | superoxide dismutase, partial | COMPARE00589 | 13 | 21155 | 2024 | KHHQTYITNYNKA | >COMPARE00589 superoxide dismutase, partial [Prosopis velutina] | View Edit Delete | |
| 3539 | Prosopis velutina | velvet mesquite | superoxide dismutase, partial | COMPARE00590 | 13 | 21155 | 2024 | KALEQLHDAMEKG | >COMPARE00590 superoxide dismutase, partial [Prosopis velutina] | View Edit Delete | |
| 3589 | Prosopis velutina | velvet mesquite | thaumatin-like, partial | COMPARE00591 | 14 | 21155 | 2024 | KVTGSDGNVIACKS | >COMPARE00591 thaumatin-like, partial [Prosopis velutina] | View Edit Delete | |
| 3590 | Prosopis velutina | velvet mesquite | thaumatin-like, partial | COMPARE00592 | 14 | 21155 | 2024 | KANINAACPNDLKV | >COMPARE00592 thaumatin-like, partial [Prosopis velutina] | View Edit Delete | |
| 3540 | Prosopis velutina | velvet mesquite | triosephosphate isomerase, partial | COMPARE00593 | 17 | 21155 | 2024 | KWIHSNVSAEVASSVRI | >COMPARE00593 triosephosphate isomerase, partial [Prosopis velutina] | View Edit Delete | |
| 3541 | Prosopis velutina | velvet mesquite | triosephosphate isomerase, partial | COMPARE00594 | 14 | 21155 | 2024 | KVIACVGETLEQRE | >COMPARE00594 triosephosphate isomerase, partial [Prosopis velutina] | View Edit Delete | |
| 3542 | Prosopis velutina | velvet mesquite | triosephosphate isomerase, partial | COMPARE00595 | 12 | 21155 | 2024 | KVAYALSQGLKV | >COMPARE00595 triosephosphate isomerase, partial [Prosopis velutina] | View Edit Delete | |
| 3543 | Prosopis velutina | velvet mesquite | triosephosphate isomerase, partial | COMPARE00597 | 15 | 21155 | 2024 | RQLFNEANEFVADKV | >COMPARE00597 triosephosphate isomerase, partial [Prosopis velutina] | View Edit Delete | |
| 3544 | Prosopis velutina | velvet mesquite | triosephosphate isomerase, partial | COMPARE00598 | 33 | 21155 | 2024 | KIVTTLNEAQVPGEDVVEVVVSPPFVFLSLVKS | >COMPARE00598 triosephosphate isomerase, partial [Prosopis velutina] | View Edit Delete | |
| 3545 | Prosopis velutina | velvet mesquite | triosephosphate isomerase, partial | COMPARE00599 | 15 | 21155 | 2024 | RIIYGGSVNGANCKE | >COMPARE00599 triosephosphate isomerase, partial [Prosopis velutina] | View Edit Delete | |
| 3546 | Prosopis velutina | velvet mesquite | triosephosphate isomerase, partial | COMPARE00600 | 10 | 21155 | 2024 | KFFVGGNWKC | >COMPARE00600 triosephosphate isomerase, partial [Prosopis velutina] | View Edit Delete | |
| 3547 | Prosopis velutina | velvet mesquite | triosephosphate isomerase, partial | COMPARE00601 | 16 | 21155 | 2024 | REAGSTMAVVAEQTKA | >COMPARE00601 triosephosphate isomerase, partial [Prosopis velutina] | View Edit Delete | |
| 3584 | Prosopis velutina | velvet mesquite | triosephosphate isomerase, partial | COMPARE00602 | 18 | 21155 | 2024 | KVATPAQAQEVHAELRKW | >COMPARE00602 triosephosphate isomerase, partial [Prosopis velutina] | View Edit Delete |