Article
R-mandelonitrile-lyase, homolog to Pru d 10, is a major peach allergen in peach allergic Spanish population
| Id | 21167 |
|---|---|
| Pubmed | 38174961 |
Authors
Lopez-Matas MA, Vilchez-Sanchez F, Alvarez F, Rodriguez-Perez R, Dominguez-Ortega J, Carnes J, Pedrosa M.
Title
R-mandelonitrile-lyase, homolog to Pru d 10, is a major peach allergen in peach allergic Spanish population
Journal
J Investig Allergol Clin Immunol. 2024 Jan 3:0
Pubmed ID
38174961Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 3696 | Prunus persica | peach | mandelonitrile lyase, partial from A0A251QUN8 | COMPARE00966 | 32 | 21167 | 2025 | GTIATEYPNTLTADGFAYNLQQQDDGKTPVER | >COMPARE00966 mandelonitrile lyase, partial from A0A251QUN8 [Prunus persica] | View Edit Delete | |
| 3648 | Prunus persica | peach | mandelonitrile lyase, partial from A0A251QUN1 | COMPARE00740 | 66 | 21167 | 2025 | DTVASYWHYHGGAIVGKVIDGNFRVMGINALRVVDGSTFPSTPASHPQGFYLMLGRYVGT KIVQER | >COMPARE00740 mandelonitrile lyase, partial from A0A251QUN1 [Prunus persica] | View Edit Delete | |
| 3647 | Prunus persica | peach | mandelonitrile lyase, partial from A0A251QUN1 | COMPARE00739 | 33 | 21167 | 2025 | FNYYSDPVDLTHCVRGMKNVGVFLSTDALKPYK | >COMPARE00739 mandelonitrile lyase, partial from A0A251QUN1 [Prunus persica] | View Edit Delete | |
| 3646 | Prunus persica | peach | mandelonitrile lyase, partial from A0A251QUN1 | COMPARE00738 | 60 | 21167 | 2025 | GTIATEYPNTLTVNGFAYNLQQQDDGKTPVERFVSEDGIDNVRSRILGGTTIINAGVYAR | >COMPARE00738 mandelonitrile lyase, partial from A0A251QUN1 [Prunus persica] | View Edit Delete | |
| 3645 | Prunus persica | peach | mandelonitrile lyase, partial from A0A251QUN1 | COMPARE00737 | 25 | 21167 | 2025 | HASDELLNKGDPDNLKVAVEAAVQK | >COMPARE00737 mandelonitrile lyase, partial from A0A251QUN1 [Prunus persica] | View Edit Delete | |
| 3644 | Prunus persica | peach | mandelonitrile lyase, partial from A0A251QUN8 | COMPARE00746 | 34 | 21167 | 2025 | VVDASTFPDEPNSHPQGFYLMLGRYVGLQILQER | >COMPARE00746 mandelonitrile lyase, partial from A0A251QUN8 [Prunus persica] | View Edit Delete | |
| 3643 | Prunus persica | peach | mandelonitrile lyase, partial from A0A251QUN8 | COMPARE00745 | 12 | 21167 | 2025 | VLDDSFRVMGIK | >COMPARE00745 mandelonitrile lyase, partial from A0A251QUN8 [Prunus persica] | View Edit Delete | |
| 3642 | Prunus persica | peach | mandelonitrile lyase, partial from A0A251QUN8 | COMPARE00744 | 17 | 21167 | 2025 | KLGDLLRTKALEPYKAR | >COMPARE00744 mandelonitrile lyase, partial from A0A251QUN8 [Prunus persica] | View Edit Delete | |
| 3641 | Prunus persica | peach | mandelonitrile lyase, partial from A0A251QUN8 | COMPARE00742 | 25 | 21167 | 2025 | HAADELLNKGDPNNLLVAVQASVEK | >COMPARE00742 mandelonitrile lyase, partial from A0A251QUN8 [Prunus persica] | View Edit Delete | |
| 3640 | Prunus persica | peach | mandelonitrile lyase, partial from A0A251QUN8 | COMPARE00741 | 17 | 21167 | 2025 | ARILGGTTIINAGVYAR | >COMPARE00741 mandelonitrile lyase, partial from A0A251QUN8 [Prunus persica] | View Edit Delete |