Article
Identification of cross-reactive and genuine Parietaria judaica pollen allergens.
| Id | 2411 |
|---|---|
| Pubmed | 12743560 |
Authors
Stumvoll S; Westritschnig K; Lidholm J; Spitzauer S; Colombo P; Duro G; Kraft D; Geraci D; Valenta R
Title
Identification of cross-reactive and genuine Parietaria judaica pollen allergens.
Journal
J Allergy Clin Immunol. 2003 May;111(5):974-9
Pubmed ID
12743560Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 823 | Parietaria judaica | pellitory | profilin | 0014423869 | Q9T0M8.1 | 131 | 2265, 2411, 2412, 2413 | 2007 | MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF LAPTGLFLGGTKYMVIQGESGAVIGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVVE RLGDYLLEQGM | >Q9T0M8.1 Par j 3; profilin [Parietaria judaica] | View Edit Delete |
| 824 | Parietaria judaica | pellitory | profilin | 0014423876 | Q9XG85.1 | 132 | 2265, 2411, 2412, 2413 | 2007 | MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV ERLGDYLLEQGL | >Q9XG85.1 Par j 3; profilin [Parietaria judaica] | View Edit Delete |
| 1916 | Parietaria judaica | pellitory | profilin | 0444175753 | CCP19647.1 | 131 | 2265, 2411, 2412, 2413 | 2014 | MSWQTYVDDHLMCEIEGNHLTAAAILGQDGSVWAQSASFPQFKPEEIAAIVKDFEEPGTL APTGLFLGGAKYMVIQGEAGVVIRGKKGSGGVTVKKTGQALVIGIYDEPMAPGQCNMIVE RLGDYLIETGL | >CCP19647.1 Par j 3; profilin [Parietaria judaica] | View Edit Delete |