Article
Olive allergen-specific IgE responses in patients with Olea europaea pollinosis.
| Id | 2572 |
|---|---|
| Pubmed | 12173270 |
Authors
Quiralte J; Florido F; Arias de Saavedra JM; Gomez A; Saenz de San Pedro B; Gonzalez E; Rodriguez R
Title
Olive allergen-specific IgE responses in patients with Olea europaea pollinosis.
Journal
Allergy. 2002;57 Suppl 71:47-52
Pubmed ID
12173270Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 604 | Olea europaea | olive | calcium-binding protein, polcalcin | 0003337403 | AAD05375.1 | 84 | 1102, 2075, 2397, 2572 | 2007 | MADDPQEVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGF ISFEEFTVFARANRGLVKDVAKIF | >AAD05375.1 Ole e 3; calcium-binding protein, polcalcin [Olea europaea] | View Edit Delete |
| 945 | Olea europaea | olive | lipid transfer protein, partial | 0022002032 | P81430.2 | 21 | 965, 2395, 2572 | 2007 | APSQSTVTALLTSCVSYIDDQ | >P81430.2 Ole e 7; lipid transfer protein, partial [Olea europaea] | View Edit Delete |
| 1080 | Olea europaea | olive | calcium-binding protein, polcalcin, partial | 0037725377 | AAO33897.1 | 52 | 1102, 2075, 2397, 2572 | 2007 | EHERIFKRFDAKGDGKISSSELGETLKPLGSVTLEEIQRMMAEIDTDGDGFL | >AAO33897.1 Ole e 3; calcium-binding protein, polcalcin, partial [Olea europaea] | View Edit Delete |