Article
Cloning of two distinct cDNAs encoding parvalbumin, the major allergen of Atlantic salmon (Salmo salar)
Id | 259 |
---|---|
Pubmed | 8845026 |
Authors
Lindstrom,C.D.; van Do,T.; Hordvik,I.; Endresen,C.; Elsayed,S.
Title
Cloning of two distinct cDNAs encoding parvalbumin, the major allergen of Atlantic salmon (Salmo salar)
Journal
Scand. J. Immunol. 44 (4), 335-344 (1996)
Pubmed ID
8845026Related Allergens
Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
---|---|---|---|---|---|---|---|---|---|---|---|
418 | Salmo salar | salmon | calcium-binding protein, parvalbumin | 0001322183 | CAA66403.1 | 109 | 259, 2308 | 2015 | MACAHLCKEADIKTALEACKAADTFSFKTFFHTIGFASKSADDVKKAFKVIDQDASGFIE VEELKLFLQNFCPKARELTDAETKAFLKAGDADGDGMIGIDEFAVLVKQ | >CAA66403.1 Sal s 1; calcium-binding protein, parvalbumin [Salmo salar] | View Edit Delete |
867 | Salmo salar | salmon | calcium-binding protein, parvalbumin | 0018281421 | Q91483.3 | 108 | 259, 2308 | 2007 | MSFAGLNDADVAAALAACTAADSFNHKAFFAKVGLASKSSDDVKKAFYVIDQDKSGFIEE DELKLFLQNFSASARALTDAETKAFLADGDKDGDGMIGVDEFAAMIKG | >Q91483.3 Sal s 1; calcium-binding protein, parvalbumin [Salmo salar] | View Edit Delete |
1621 | Salmo salar | salmon | calcium-binding protein, parvalbumin | 0209734468 | ACI68103.1 | 109 | 259, 2308 | 2010 | MACAHLCKEADIKTALEACKAADTFNFKTFFHTIGFASKSADDVKKAFKVIDQDASGFIE VEELKLFLQNFCPKARELTDAETKAFLKAGDADGDGMIGIDEFAVLVKQ | >ACI68103.1 Sal s 1; calcium-binding protein, parvalbumin [Salmo salar] | View Edit Delete |