Article

Skin prick tests reveal stable and heritable reduction of allergenic potency of gene-silenced tomato fruits.

Id	3186
Pubmed	16950292

Lorenz Y; Enrique E; Lequynh L; Fotisch K; Retzek M; Biemelt S; Sonnewald U; Vieths S; Scheurer S

J Allergy Clin Immunol. 2006 Sep;118(3):711-8

16950292

Id	Species	Common Name	Definition	Gi	Accession	Length	Reference	Year Adopted	Sequence	Header	Actions
494	Solanum lycopersicum	tomato	lipid transfer protein	0001816535	AAB42069.1	114	3186	2015	MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRGPLGGCCGGVKGLLGA AKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ	>AAB42069.1 Sola l 3; lipid transfer protein [Solanum lycopersicum]	View Edit Delete
1248	Solanum lycopersicum	tomato	lipid transfer protein	0071360928	CAJ19705.1	114	3186	2007	MEMVNKIACFVLLCMVVVAPHAEALTCGQVTSTLAPCLPYLMNRGPLRNCCDGVKGLLGQ AKTTVDRQAACTCLKSAASSFTGLNLGKAAALPNTCSVNIPYKISPSTDCSKVQ	>CAJ19705.1 Sola l 3; lipid transfer protein [Solanum lycopersicum]	View Edit Delete