Article

Cross-reactivity and 1.4-A crystal structure of Malassezia sympodialis thioredoxin (Mala s 13), a member of a new pan-allergen family.

Id	4502
Pubmed	17182577

Limacher A; Glaser AG; Meier C; Schmid-Grendelmeier P; Zeller S; Scapozza L; Crameri R

J Immunol. 2007 Jan 1;178(1):389-96

17182577

Id	Species	Common Name	Definition	Gi	Accession	Length	Reference	Year Adopted	Sequence	Header	Actions
1342	Aspergillus fumigatus	fungus	thioredoxin	0091680607	CAI78449.1	108	4502, 19512	2007	MSHGKVIAVDNPIIYKALTSSGPVVVDFFATWCGPCRAVAPKVGELSEKYSNVRFIQVDV DKVRSVAHEMNIRAMPTFVLYKDGQPLEKRVVGGNVRELEEMIKSISA	>CAI78449.1 Asp f 28; thioredoxin [Aspergillus fumigatus]	View Edit Delete
1343	Aspergillus fumigatus	fungus	thioredoxin	0091680609	CAI78450.1	110	4502, 19512	2007	MSHNVEKITDAKVFKEKVQEGSGPVIVDCSATWCGPCKAISPVFQRLSTSEEFKNAKFYE IDVDELSEVAAELGVRAMPTFMFFKDGQKVNEVVGANPPALEAAIKAHVA	>CAI78450.1 Asp f 29; thioredoxin [Aspergillus fumigatus]	View Edit Delete
1922	Malassezia sympodialis	yeast	thioredoxin	0465793078	CCU98198.1	107	4502	2014	MGVQVISSYDQFKQVTGGDKVVVIDFWATWCGPCKMIGPVFEKISDTPAGDKVGFYKVDV DEQSQIAQEVGIRAMPTFVFFKNGQKIDTVVGADPSKLQAAITQHSA	>CCU98198.1 Mala s 13; thioredoxin [Malassezia sympodialis]	View Edit Delete