Article
Structural characterization of the tetrameric form of the major cat allergen Fel d 1.
| Id | 4538 |
|---|---|
| Pubmed | 17543334 |
Authors
Kaiser L; Velickovic TC; Badia-Martinez D; Adedoyin J; Thunberg S; Hallen D; Berndt K; Gronlund H; Gafvelin G; van Hage M; Achour A
Title
Structural characterization of the tetrameric form of the major cat allergen Fel d 1.
Journal
J Mol Biol. 2007 Jul 20;370(4):714-27
Pubmed ID
17543334Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 176 | Felis catus | cat | uteroglobin | 0000163823 | AAC41616.1 | 109 | 51, 95, 882, 1220, 2302, 2303, 2306, 4538 | 2012 | MRGALLVLALLVTQALGVKMAETCPIFYDVFFAVANGNELLLDLSLTKVNATEPERTAMK KIQDCYVENGLISRVLDGLVMTTISSSKDCMGEAVQNTVEDLKLNTLGR | >AAC41616.1 Fel d 1; uteroglobin [Felis catus] | View Edit Delete |
| 177 | Felis catus | cat | uteroglobin | 0000163825 | AAC37318.1 | 92 | 51, 95, 882, 1220, 2302, 2303, 2306, 4538 | 2007 | MKGARVLVLLWAALLLIWGGNCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENA RILKNCVDAKMTEEDKENALSLLDKIYTSPLC | >AAC37318.1 Fel d 1; uteroglobin [Felis catus] | View Edit Delete |
| 250 | Felis catus | cat | uteroglobin | 0000395407 | CAA44345.1 | 107 | 51, 95, 882, 1220, 2302, 2303, 2306, 4538 | 2008 | MRGALLVLALLVTQALGVKMAETCPIFYDVFFAVANGNELLLDLSLTKVNATEPERTAMK KIQDCYVENGLISRVLDGLVMIAINEYCMGEAVQNTVEDLKLNTLGR | >CAA44345.1 Fel d 1; uteroglobin [Felis catus] | View Edit Delete |
| 379 | Felis catus | cat | uteroglobin | 0001169665 | P30438.2 | 92 | 51, 95, 882, 1220, 2302, 2303, 2306, 4538 | 2007 | MKGACVLVLLWAALLLISGGNCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENA RILKNCVDAKMTEEDKENALSVLDKIYTSPLC | >P30438.2 Fel d 1; uteroglobin [Felis catus] | View Edit Delete |
| 440 | Felis catus | cat | uteroglobin | 0001364212 | CAA44343.1 | 88 | 51, 95, 882, 1220, 2302, 2303, 2306, 4538 | 2007 | VRRSPSTLPYCCGHSRDCEICPAVKRDVDLFLTGTPDEYVEQVAQYNALPVVLENARILK NCVDAKMTEEDKENALSVLDKIYTSPLC | >CAA44343.1 Fel d 1; uteroglobin [Felis catus] | View Edit Delete |
| 441 | Felis catus | cat | uteroglobin | 0001364213 | CAA44344.1 | 92 | 51, 95, 882, 1220, 2302, 2303, 2306, 4538 | 2007 | EGGLCSRASLGCLALDLGWKDCEICPAVKRDVDLFLTGTPDEYVEQVAQYNALPVVLENA RILKNCVDAKMTEEDKENALSVLDKIYTSPLC | >CAA44344.1 Fel d 1; uteroglobin [Felis catus] | View Edit Delete |
| 1391 | Felis catus | cat | uteroglobin | 0114326420 | NP_001041618.1 | 88 | 51, 95, 882, 1220, 2302, 2303, 2306, 4538 | 2008 | MLDAALPPCPTVAATADCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILK NCVDAKMTEEDKENALSLLDKIYTSPLC | >NP_001041618.1 Fel d 1; uteroglobin [Felis catus] | View Edit Delete |