Article
Expression and genomic structure of the genes encoding FdI, the major allergen from the domestic cat
| Id | 882 |
|---|---|
| Pubmed | 1572548 |
Authors
Griffith,I.J.; Craig,S.; Pollock,J.; Yu,X.B.; Morgenstern,J.P.; Rogers,B.L.
Title
Expression and genomic structure of the genes encoding FdI, the major allergen from the domestic cat
Journal
Gene 113 (2), 263-268 (1992)
Pubmed ID
1572548Related Allergens
| Id | Species | Common Name | Definition | Gi | Accession | Length | Reference | Year Adopted | Sequence | Header | Actions |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 176 | Felis catus | cat | uteroglobin | 0000163823 | AAC41616.1 | 109 | 51, 95, 882, 1220, 2302, 2303, 2306, 4538 | 2012 | MRGALLVLALLVTQALGVKMAETCPIFYDVFFAVANGNELLLDLSLTKVNATEPERTAMK KIQDCYVENGLISRVLDGLVMTTISSSKDCMGEAVQNTVEDLKLNTLGR | >AAC41616.1 Fel d 1; uteroglobin [Felis catus] | View Edit Delete |
| 177 | Felis catus | cat | uteroglobin | 0000163825 | AAC37318.1 | 92 | 51, 95, 882, 1220, 2302, 2303, 2306, 4538 | 2007 | MKGARVLVLLWAALLLIWGGNCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENA RILKNCVDAKMTEEDKENALSLLDKIYTSPLC | >AAC37318.1 Fel d 1; uteroglobin [Felis catus] | View Edit Delete |
| 250 | Felis catus | cat | uteroglobin | 0000395407 | CAA44345.1 | 107 | 51, 95, 882, 1220, 2302, 2303, 2306, 4538 | 2008 | MRGALLVLALLVTQALGVKMAETCPIFYDVFFAVANGNELLLDLSLTKVNATEPERTAMK KIQDCYVENGLISRVLDGLVMIAINEYCMGEAVQNTVEDLKLNTLGR | >CAA44345.1 Fel d 1; uteroglobin [Felis catus] | View Edit Delete |
| 379 | Felis catus | cat | uteroglobin | 0001169665 | P30438.2 | 92 | 51, 95, 882, 1220, 2302, 2303, 2306, 4538 | 2007 | MKGACVLVLLWAALLLISGGNCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENA RILKNCVDAKMTEEDKENALSVLDKIYTSPLC | >P30438.2 Fel d 1; uteroglobin [Felis catus] | View Edit Delete |
| 440 | Felis catus | cat | uteroglobin | 0001364212 | CAA44343.1 | 88 | 51, 95, 882, 1220, 2302, 2303, 2306, 4538 | 2007 | VRRSPSTLPYCCGHSRDCEICPAVKRDVDLFLTGTPDEYVEQVAQYNALPVVLENARILK NCVDAKMTEEDKENALSVLDKIYTSPLC | >CAA44343.1 Fel d 1; uteroglobin [Felis catus] | View Edit Delete |
| 441 | Felis catus | cat | uteroglobin | 0001364213 | CAA44344.1 | 92 | 51, 95, 882, 1220, 2302, 2303, 2306, 4538 | 2007 | EGGLCSRASLGCLALDLGWKDCEICPAVKRDVDLFLTGTPDEYVEQVAQYNALPVVLENA RILKNCVDAKMTEEDKENALSVLDKIYTSPLC | >CAA44344.1 Fel d 1; uteroglobin [Felis catus] | View Edit Delete |
| 1391 | Felis catus | cat | uteroglobin | 0114326420 | NP_001041618.1 | 88 | 51, 95, 882, 1220, 2302, 2303, 2306, 4538 | 2008 | MLDAALPPCPTVAATADCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILK NCVDAKMTEEDKENALSLLDKIYTSPLC | >NP_001041618.1 Fel d 1; uteroglobin [Felis catus] | View Edit Delete |