Allergen

AAB09252.1

Accession AAB09252.1
External DB Link NCBI Protein
Species Glycine max
Common Name soybean
Description thiol protease
IUIS Name
Length 379
Year Adopted 2007
Sequence >AAB09252.1 thiol protease [Glycine max]
MGFLVLLLFSLLGLSSSSSISTHRSILDLDLTKFTTQKQVSSLFQLWKSEHGRVYHNHEE
EAKRLEIFKNNSNYIRDMNANRKSPHSHRLGLNKFADITPQEFSKKYLQAPKDVSQQIKM
ANKKMKKEQYSCDHPPASWDWRKKGVITQVKYQGGCGRGWAFSATGAIEAAHAIATGDLV
SLSEQELVDCVEESEGSYNGWQYQSFEWVLEHGGIATDDDYPYRAKEGRCKANKIQDKVT
IDGYETLIMSDESTESETEQAFLSAILEQPISVSIDAKDFHLYTGGIYDGENCTSPYGIN
HFVLLVGYGSADGVDYWIAKNSWGEDWGEDGYIWIQRNTGNLLGVCGMNYFASYPTKEES
ETLVSARVKGHRRVDHSPL
Parent Accession

Related Articles

Pubmed Authors Title Journal
12119503 Franck P; Moneret Vautrin DA; Dousset B; Kanny G; Nabet P; Guenard-Bilbaut L; Parisot L The allergenicity of soybean-based products is modified by food technologies. Int Arch Allergy Immunol. 2002 Jul;128(3):212-9
1819644 Ogawa T; Bando N; Tsuji H; Okajima H; Nishikawa K; Sasaoka K Investigation of the IgE-binding proteins in soybeans by immunoblotting with the sera of the soybean-sensitive patients with atopic dermatitis. J Nutr Sci Vitaminol (Tokyo). 1991 Dec;37(6):555-65
10669862 Helm RM; Cockrell G; Connaughton C; West CM; Herman E; Sampson HA; Bannon GA; Burks AW Mutational analysis of the IgE-binding epitopes of P34/Gly m Bd 30K. J Allergy Clin Immunol. 2000 Feb;105(2 Pt 1):378-84
9751845 Helm R; Cockrell G; Herman E; Burks A; Sampson H; Bannon G Cellular and molecular characterization of a major soybean allergen. Int Arch Allergy Immunol. 1998 Sep;117(1):29-37
19241594 Wilson S; Martinez-Villaluenga C; De Mejia EG Purification, thermal stability, and antigenicity of the immunodominant soybean allergen P34 in soy cultivars, ingredients, and products. J Food Sci. 2008 Aug;73(6):T106-14
22102143 Morita H; Kaneko H; Ohnishi H; Kato Z; Kubota K; Yamamoto T; Matsui E; Teramoto T; Fukao T; Kasahara K; Kondo N Structural property of soybean protein P34 and specific IgE response to recombinant P34 in patients with soybean allergy. Int J Mol Med. 2012 Feb;29(2):153-8