Allergen

AAB32842.1

Accession AAB32842.1
External DB Link NCBI Protein
Species Dermatophagoides pteronyssinus
Common Name house dust mite
Description unknown function
IUIS Name Der p 5
Length 132
Year Adopted 2007
Sequence >AAB32842.1 Der p 5; unknown function [Dermatophagoides pteronyssinus]
MKFIIAFFVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKKGELALFYLQEQINHFE
AKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMAKKSGDILERDL
KKEEARVKKIEV
Parent Accession

Related Articles

Pubmed Authors Title Journal
7798547 Lin,K.L.; Hsieh,K.H.; Thomas,W.R.; Chiang,B.L.; Chua,K.Y. Characterization of Der p V allergen, cDNA analysis, and IgE-mediated reactivity to the recombinant protein J. Allergy Clin. Immunol. 94 (6 PT 1), 989-996 (1994)
2794865 Tovey,E.R.; Johnson,M.C.; Roche,A.L.; Cobon,G.S.; Baldo,B.A. Cloning and sequencing of a cDNA expressing a recombinant house dust mite protein that binds human IgE and corresponds to an important low molecular weight allergen J. Exp. Med. 170 (4), 1457-1462 (1989)
12580807 Simpson A; Green R; Custovic A; Woodcock A; Arruda LK; Chapman MD Skin test reactivity to natural and recombinant Blomia and Dermatophagoides spp. allergens among mite allergic patients in the UK. Allergy. 2003 Jan;58(1):53-6
18220991 Thomas WR; Heinrich TK; Smith WA; Hales BJ Pyroglyphid house dust mite allergens. Protein Pept Lett. 2007;14(10):943-53
7823971 ONeill GM, Donovan GR, Baldo BA Sequence analyses of the native form of a major house dust mite allergen and its nascent polypeptide. Mol Immunol. 1994 Dec;31(18):1447-8
20534590 Mueller,G.A.; Gosavi,R.A.; Krahn,J.M.; Edwards,L.L.; Cuneo,M.J.; Glesner,J.; Pomes,A.; Chapman,M.D.; London,R.E.; Pedersen,L.C.; Der p 5 crystal structure provides insight into the group 5 dust mite allergens J. Biol. Chem. 285 (33), 25394-25401 (2010)