Allergen

AAD05375.1

Accession AAD05375.1
External DB Link NCBI Protein
Species Olea europaea
Common Name olive
Description calcium-binding protein, polcalcin
IUIS Name Ole e 3
Length 84
Year Adopted 2007
Sequence >AAD05375.1 Ole e 3; calcium-binding protein, polcalcin [Olea europaea]
MADDPQEVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGF
ISFEEFTVFARANRGLVKDVAKIF
Parent Accession

Related Articles

Pubmed Authors Title Journal
9874211 Ledesma,A.; Villalba,M.; Batanero,E.; Rodriguez,R. Molecular cloning and expression of active Ole e 3, a major allergen from olive-tree pollen and member of a novel family of Ca2+-binding proteins (polcalcins) involved in allergy Eur. J. Biochem. 258 (2), 454-459 (1998)
8944765 Batanero E; Villalba M; Ledesma A; Puente XS; Rodriguez R Ole e 3, an olive-tree allergen, belongs to a widespread family of pollen proteins. Eur J Biochem. 1996 Nov 1;241(3):772-8
12372128 Ledesma A; Gonzalez E; Pascual CY; Quiralte J; Villalba M; Rodriguez R Are Ca2+-binding motifs involved in the immunoglobin E-binding of allergens? Olive pollen allergens as model of study. Clin Exp Allergy. 2002 Oct;32(10):1476-83
12173270 Quiralte J; Florido F; Arias de Saavedra JM; Gomez A; Saenz de San Pedro B; Gonzalez E; Rodriguez R Olive allergen-specific IgE responses in patients with Olea europaea pollinosis. Allergy. 2002;57 Suppl 71:47-52