Allergen

AAD29409.1

Accession AAD29409.1
External DB Link NCBI Protein
Species Apium graveolens
Common Name celery
Description profilin
IUIS Name Api g 4
Length 134
Year Adopted 2007
Sequence >AAD29409.1 Api g 4; profilin [Apium graveolens]
MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP
GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV
IVERLGDYLIDQGL
Parent Accession

Related Articles

Pubmed Authors Title Journal
10848918 Scheurer,S.; Wangorsch,A.; Haustein,D.; Vieths,S. Cloning of the minor allergen Api g 4 profilin from celery (Apium graveolens) and its cross-reactivity with birch pollen profilin Bet v 2 Clin. Exp. Allergy 30 (7), 962-971 (2000)
11906337 Ballmer-Weber BK; Hoffmann A; Wuthrich B; Luttkopf D; Pompei C; Wangorsch A; Kastner M; Vieths S Influence of food processing on the allergenicity of celery: DBPCFC with celery spice and cooked celery in patients with celery allergy. Allergy. 2002 Mar;57(3):228-35