Allergen

AET05732.1

Accession AET05732.1
External DB Link NCBI Protein
Species Pyrus communis
Common Name pear
Description lipid transfer protein
IUIS Name Pyr c 3
Length 94
Year Adopted 2013
Sequence >AET05732.1 Pyr c 3; lipid transfer protein [Pyrus communis]
AHAITCSQVSSNLAPCINYVRSGGAVPPACCNGIKTINGLANTTPDRQAACNCLKNLAGS
VSGVNPGNAESLPGKCGVNVPCKISTPTNCATVK
Parent Accession

Related Articles

Pubmed Authors Title Journal
11476467 Asero R; Mistrello G; Roncarolo D; Casarini M; Falagiani P Allergy to nonspecific lipid transfer proteins in Rosaceae: a comparative study of different in vivo diagnostic methods. Ann Allergy Asthma Immunol. 2001 Jul;87(1):68-71
10469033 Fernandez-Rivas M; Cuevas M Peels of Rosaceae fruits have a higher allergenicity than pulps. Clin Exp Allergy. 1999 Sep;29(9):1239-47
22015956 Ramazzina,I.; Amato,S.; Passera,E.; Sforza,S.; Mistrello,G.; Berni,R.; Folli,C.; Isoform identification, recombinant production and characterization of the allergen lipid transfer protein 1 from pear (Pyr c 3) Gene 491 (2), 173-181 (2012)