Allergen

BAC66618.1

Accession BAC66618.1
External DB Link NCBI Protein
Species Scomber japonicus
Common Name chub mackerel
Description calcium-binding protein, parvalbumin
IUIS Name
Length 109
Year Adopted 2007
Sequence >BAC66618.1 calcium-binding protein, parvalbumin [Scomber japonicus]
MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE
EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIKG
Parent Accession

Related Articles

Pubmed Authors Title Journal
12842183 Hamada,Y.; Tanaka,H.; Ishizaki,S.; Ishida,M.; Nagashima,Y.; Shiomi,K. Purification, reactivity with IgE and cDNA cloning of parvalbumin as the major allergen of mackerels Food Chem Toxicol. 2003 Aug;41(8):1149-56.
16337465 Van Do T; Elsayed S; Florvaag E; Hordvik I; Endresen C Allergy to fish parvalbumins: studies on the cross-reactivity of allergens from 9 commonly consumed fish. J Allergy Clin Immunol. 2005 Dec;116(6):1314-20
16436146 Kobayashi A; Tanaka H; Hamada Y; Ishizaki S; Nagashima Y; Shiomi K Comparison of allergenicity and allergens between fish white and dark muscles. Allergy. 2006 Mar;61(3):357-63
20559001 Kuehn A; Scheuermann T; Hilger C; Hentges F Important Variations in Parvalbumin Content in Common Fish Species: A Factor Possibly Contributing to Variable Allergenicity. Int Arch Allergy Immunol. 2010 Jun 17;153(4):359-366