Allergen

CAQ72971.1

Accession CAQ72971.1
External DB Link NCBI Protein
Species Clupea harengus
Common Name Atlantic herring
Description calcium-binding protein, parvalbumin
IUIS Name Clu h 1
Length 110
Year Adopted 2011
Sequence >CAQ72971.1 Clu h 1; calcium-binding protein, parvalbumin [Clupea harengus]
MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE
EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVKAR
Parent Accession

Related Articles

Pubmed Authors Title Journal
16337465 Van Do T; Elsayed S; Florvaag E; Hordvik I; Endresen C Allergy to fish parvalbumins: studies on the cross-reactivity of allergens from 9 commonly consumed fish. J Allergy Clin Immunol. 2005 Dec;116(6):1314-20
20559001 Kuehn A; Scheuermann T; Hilger C; Hentges F Important Variations in Parvalbumin Content in Common Fish Species: A Factor Possibly Contributing to Variable Allergenicity. Int Arch Allergy Immunol. 2010 Jun 17;153(4):359-366
20559001 Kuehn A; Scheuermann T; Hilger C; Hentges F Important Variations in Parvalbumin Content in Common Fish Species: A Factor Possibly Contributing to Variable Allergenicity. Int Arch Allergy Immunol. 2010 Jun 17;153(4):359-366
24795722 Kuehn A; Swoboda I; Arumugam K; Hilger C; Hentges F Fish allergens at a glance: variable allergenicity of parvalbumins, the major fish allergens. Front Immunol. 2014;5:179
23763969 Swoboda I; Balic N; Klug C; Focke M; Weber M; Spitzauer S; Neubauer A; Quirce S; Douladiris N; Papadopoulos NG; Valenta R A general strategy for the generation of hypoallergenic molecules for the immunotherapy of fish allergy. J Allergy Clin Immunol. 2013 Oct;132(4):979-81.e1