Allergen

P0C088.1

Accession P0C088.1
External DB Link NCBI Protein
Species Artemisia vulgaris
Common Name mugwort
Description lipid transfer protein
IUIS Name Art v 3
Length 37
Year Adopted 2007
Sequence >P0C088.1 Art v 3; lipid transfer protein [Artemisia vulgaris]
ALTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGLND
Parent Accession

Related Articles

Pubmed Authors Title Journal
10998016 Diaz-Perales,A.; Lombardero,M.; Sanchez-Monge,R.; Garcia-Selles,F.J.; Pernas,M.; Fernandez-Rivas,M.; Barber,D.; Salcedo,G.; Lipid-transfer proteins as potential plant panallergens: cross-reactivity among proteins of Artemisia pollen, Castanea nut and Rosaceae fruits, with different IgE-binding capacities Clin. Exp. Allergy 30 (10), 1403-1410 (2000)
12170274 Pastorello EA; Pravettoni V; Farioli L; Rivolta F; Conti A; Ispano M; Fortunato D; Bengtsson A; Bianchi M Hypersensitivity to mugwort (Artemisia vulgaris) in patients with peach allergy is due to a common lipid transfer protein allergen and is often without clinical expression. J Allergy Clin Immunol. 2002 Aug;110(2):310-7
19406480 Gadermaier,G.; Harrer,A.; Girbl,T.; Palazzo,P.; Himly,M.; Vogel,L.; Briza,P.; Mari,A.; Ferreira,F.; Isoform identification and characterization of Art v 3, the lipid-transfer protein of mugwort pollen Mol. Immunol. 46 (10), 1919-1924 (2009)