Allergen

Q9T0M8.1

Accession Q9T0M8.1
External DB Link NCBI Protein
Species Parietaria judaica
Common Name pellitory
Description profilin
IUIS Name Par j 3
Length 131
Year Adopted 2007
Sequence >Q9T0M8.1 Par j 3; profilin [Parietaria judaica]
MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF
LAPTGLFLGGTKYMVIQGESGAVIGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVVE
RLGDYLLEQGM
Parent Accession

Related Articles

Pubmed Authors Title Journal
11958736 Benitez D; Garcia-Ortega P; Picado C; Mila J; Vives J; Martinez J; Vilella R Specific immune response to Parietaria judaica plant profilin: a low T cell proliferative response supports high IgE and skin prick test. Allergol Immunopathol (Madr). 2002 Mar;30(2):62-69
12743560 Stumvoll S; Westritschnig K; Lidholm J; Spitzauer S; Colombo P; Duro G; Kraft D; Geraci D; Valenta R Identification of cross-reactive and genuine Parietaria judaica pollen allergens. J Allergy Clin Immunol. 2003 May;111(5):974-9
14739580 Asero R; Mistrello G; Roncarolo D; Amato S Parietaria profilin shows only limited cross-reactivity with birch and grass profilins. Int Arch Allergy Immunol. 2004 Feb;133(2):121-4
15160441 Asturias JA; Ibarrola I; Eseverri JL; Arilla MC; Gonzalez-Rioja R; Martinez A PCR-based cloning and immunological characterization of Parietaria judaica pollen profilin. J Investig Allergol Clin Immunol. 2004;14(1):43-8