Allergen

NP_001041618.1

Accession NP_001041618.1
External DB Link NCBI Protein
Species Felis catus
Common Name cat
Description uteroglobin
IUIS Name Fel d 1
Length 88
Year Adopted 2008
Sequence >NP_001041618.1 Fel d 1; uteroglobin [Felis catus]
MLDAALPPCPTVAATADCEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILK
NCVDAKMTEEDKENALSLLDKIYTSPLC
Parent Accession

Related Articles

Pubmed Authors Title Journal
1946388 Morgenstern,J.P.; Griffith,I.J.; Brauer,A.W.; Rogers,B.L.; Bond,J.F.; Chapman,M.D.; Kuo,M.C. Amino acid sequence of Fel dI, the major allergen of the domestic cat: protein sequence analysis and cDNA cloning Proc. Natl. Acad. Sci. U.S.A. 88 (21), 9690-9694 (1991)
6747135 Leitermann,K.; Ohman,J.L. Jr. Cat allergen 1: Biochemical, antigenic, and allergenic properties J. Allergy Clin. Immunol. 74 (2), 147-153 (1984)
1572548 Griffith,I.J.; Craig,S.; Pollock,J.; Yu,X.B.; Morgenstern,J.P.; Rogers,B.L. Expression and genomic structure of the genes encoding FdI, the major allergen from the domestic cat Gene 113 (2), 263-268 (1992)
12777788 Kaiser,L.; Gronlund,H.; Sandalova,T.; Ljunggren,H.G.; Schneider,G.; van Hage-Hamsten,M.; Achour,A. Production, crystallization and preliminary crystallographic study of the major cat allergen Fel d 1 Acta Crystallogr. D Biol. Crystallogr. 59 (Pt 6), 1103-1105 (2003)
15546862 Seppala U; Hagglund P; Wurtzen PA; Ipsen H; Thorsted P; Lenhard T; Roepstorff P; Spangfort MD Molecular characterization of major cat allergen Fel d 1: expression of heterodimer by use of a baculovirus expression system. J Biol Chem. 2005 Feb 4;280(5):3208-16
7680928 Kleine-Tebbe J; Kleine-Tebbe A; Jeep S; Schou C; Lowenstein H; Kunkel G Role of the major allergen (Fel d I) in patients sensitized to cat allergens. Int Arch Allergy Immunol. 1993;100(3):256-62
10589005 van Ree R; van Leeuwen WA; Bulder I; Bond J; Aalberse RC Purified natural and recombinant Fel d 1 and cat albumin in in vitro diagnostics for cat allergy. J Allergy Clin Immunol. 1999 Dec;104(6):1223-30
17543334 Kaiser L; Velickovic TC; Badia-Martinez D; Adedoyin J; Thunberg S; Hallen D; Berndt K; Gronlund H; Gafvelin G; van Hage M; Achour A Structural characterization of the tetrameric form of the major cat allergen Fel d 1. J Mol Biol. 2007 Jul 20;370(4):714-27